PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G188500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 322aa    MW: 34890 Da    PI: 5.9729
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G188500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1217.3e-071912361863
                         HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  18 rrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         +rsR RK+++i+eLe+ v++L++   +L+ ++ +l ++  +l +e+
  Sevir.1G188500.1.p 191 QRSRVRKLQYIAELERTVDSLQNMGADLAVRVASLFQLHNALSMEN 236
                         79**************************999999999888888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147034.39E-16186230No hitNo description
Gene3DG3DSA:1.20.5.1702.9E-4191246No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MSRSPHLPPR CPPLGPQITR RDDSLFTQSC RFPSGDPFYG EPPCWLDDLL ADSGKVPNLP  60
PLRRACSDSD AILDALSVFQ SPIHPIEEGD LSPGGEAKDL LDAVEGGESS SLVEASCVYG  120
PNSPRQKSSL TTSESSMVNA VLENVPSNPL QYLTIDASSG VNGNVANGTA DATDAFGHPD  180
QDKSFKRRPG QRSRVRKLQY IAELERTVDS LQNMGADLAV RVASLFQLHN ALSMENEQLR  240
IQISNLQHAK LIKDGQTQAL KNEAERLKQM SARHRRSRSV TSCYNMSPYG DAPAVNWQMP  300
DMAKLSLNDS SVSPRGGGYG L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952673.10.0PREDICTED: basic leucine zipper 34
TrEMBLK3YU630.0K3YU63_SETIT; Uncharacterized protein
STRINGSi017809m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP81372631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-16bZIP family protein